return to MFP index | return to IonSource

Bovine Serum Albumin  58@C

(BSA)

 

 

Expasy Bovine Serum Albumin Page P02769

>P02769|ALBU_BOVIN Serum albumin - Bos taurus (Bovine).
MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPF
DEHVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCKVASLRETYGDMADCCEKQEP
ERNECFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYY
ANKYNGVFQECCQAEDKGACLLPKIETMREKVLASSARQRLRCASIQKFGERALKAWSVA
RLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLLECADDRADLAKYICDNQDTISSKLKE
CCDKPLLEKSHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAKDAFLGSFLYEYSRR
HPEYAVSVLLRLAKEYEATLEECCAKDDPHACYSTVFDKLKHLVDEPQNLIKQNCDQFEK
LGEYGFQNALIVRYTRKVPQVSTPTLVEVSRSLGKVGTRCCTKPESERMPCTEDYLSLIL
NRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTLP
DTEKQIKKQTALVELLKHKPKATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPKLVV
STQTALA
(signal sequence and all cysteines shown in red)
 

				
Download BSA PIR file
Elemental composition:	c2932 H4614 N780 O898 S39  
Monoistopic Mass		66389.86  (25-607)
Average Mass		66432.96  (25-607)
pI			5.60
(modified cys not taken into account in the intact mass and pI calculations shown above)
 
 
Trypsin Digest
Cys modified with iodoacetic acid
 





				
BSA (Cys modified with Iodoacetic acid) Monoisotopic Mass    
       
peptide sequence 1Z 2Z 3Z 4Z
K 147.1128 74.0564 49.7043 37.5282
R 175.1189 88.0595 59.0396 44.5297
LK 260.1968 130.5984 87.3989 65.7992
EK 276.1554 138.5777 92.7185 69.7889
LR 288.2030 144.6015 96.7343 72.8008
FK 294.1812 147.5906 98.7271 74.2953
QR 303.1775 152.0888 101.7258 76.5444
ALK 331.2340 166.1170 111.0780 83.5585
LAK 331.2340 166.1170 111.0780 83.5585
VTK 347.2289 174.1145 116.4096 87.5572
VHK 383.2401 192.1201 128.4134 96.5600
QIK 388.2554 194.6277 130.0851 97.8139
FPK 391.2340 196.1170 131.0780 98.5585
SLGK 404.2503 202.6252 135.4168 101.8126
VGTR 432.2565 216.6283 144.7522 108.8141
YTR 439.2299 220.1150 147.0766 110.5575
ADEK 462.2194 231.6097 154.7398 116.3049
DVCK 522.2228 261.6114 174.7409 131.3057
LSQK 475.2875 238.1438 159.0958 119.5719
DTHK 500.2463 250.6232 167.4154 125.8116
FGER 508.2514 254.6257 170.0838 127.8129
HKPK 509.3194 255.1597 170.4398 128.0799
ADLAK 517.2980 259.1490 173.0993 130.0745
FWGK 537.2820 269.1410 179.7607 135.0705
VASLR 545.3405 273.1703 182.4468 137.0851
AFDEK 609.2878 305.1439 203.7626 153.0720
IETMR 649.3338 325.1669 217.1113 163.0835
CASIQK 707.3392 354.1696 236.4464 177.5848
QEPER 658.3155 329.6578 220.1052 165.3289
TPVSEK 660.3563 330.6782 220.7854 165.8391
AWSVAR 689.3729 345.1865 230.4576 173.0932
GACLLPK 759.4069 380.2035 253.8023 190.6017
VLASSAR 703.4097 352.2049 235.1366 176.6024
SEIAHR 712.3736 356.6868 238.1245 178.8434
CCAADDK 841.2702 421.1351 281.0901 211.0676
NYQEAK 752.3573 376.6787 251.4524 188.8393
LVTDLTK 789.4716 395.2358 263.8239 198.1179
ATEEQLK 818.4254 409.7127 273.4751 205.3564
LCVLHEK 899.4655 450.2328 300.4885 225.6164
DDSPDLPK 886.4152 443.7076 296.1384 222.3538
AEFVEVTK 922.4880 461.7440 308.1627 231.3720
YLYEIAR 927.4934 464.2467 309.8311 232.6234
DLGEEHFK 974.4577 487.7289 325.4859 244.3644
NECFLSHK 1035.4564 518.2282 345.8188 259.6141
LVVSTQTALA 1002.5830 501.7915 334.8610 251.3958
QNCDQFEK 1069.4255 535.2128 357.1418 268.1064
QTALVELLK 1014.6193 507.8097 338.8731 254.4048
SHCIAEVEK 1073.4931 537.2466 358.4977 269.1233
CCTESLVNR 1140.4660 570.7330 380.8220 285.8665
EACFAVEGPK 1108.4979 554.7490 370.1660 277.8745
CCTKPESER 1168.4609 584.7305 390.1536 292.8652
LVNELTEFAK 1163.6306 582.3153 388.5435 291.6577
ECCDKPLLEK 1293.5701 647.2851 431.8567 324.1425
HPEYAVSVLLR 1283.7106 642.3553 428.5702 321.6777
HLVDEPQNLIK 1305.7161 653.3581 435.9054 327.1790
TCVADESHAGCEK 1465.5569 733.2785 489.1856 367.1392
SLHTLFGDELCK 1420.6776 710.8388 474.2259 355.9194
ETYGDMADCCEK 1480.4912 740.7456 494.1637 370.8728
YICDNQDTISSK 1444.6260 722.8130 482.2087 361.9065
EYEATLEECCAK 1504.5818 752.7909 502.1939 376.8955
TVMENFVAFVDK 1399.6926 700.3463 467.2309 350.6732
LGEYGFQNALIVR 1479.7954 740.3977 493.9318 370.6989
DDPHACYSTVFDK 1555.6369 778.3185 519.2123 389.6592
VPQVSTPTLVEVSR 1511.8427 756.4214 504.6142 378.7107
LKPDPNTLCDEFK 1577.7515 789.3758 526.5838 395.1879
DAFLGSFLYEYSR 1567.7427 784.3714 523.2476 392.6857
ECCHGDLLECADDR 1752.6145 876.8073 584.8715 438.9036
YNGVFQECCQAEDK 1749.6730 875.3365 583.8910 438.1683
MPCTEDYLSLILNR 1725.8186 863.4093 575.9395 432.2047
RPCFSALTPDETYVPK 1881.9051 941.4526 627.9684 471.2263
LFTFHADICTLPDTEK 1908.9047 954.9524 636.9682 477.9762
HPYFYAPELLYYANK 1888.9268 944.9634 630.3089 472.9817
DAIPENLPPLTADFAEDK 1955.9596 978.4798 652.6532 489.7399
GLVLIAFSQYLQQCPFDEHV K 2493.2482 1247.1241 831.7494 624.0621
 

 

 

 

 

 

home | disclaimer
Copyright 2000-2016  IonSource.com  All rights reserved. 
Last updated:  Tuesday, January 19, 2016 02:49:46 PM