return to MFP index | return to IonSource

Bovine Beta Casein

 

Expasy Bovine Beta Casein Page  P02666

Fasta Format

>P02666|CASB_BOVIN Beta-casein [Contains: Casoparan] - Bos taurus (Bovine).
MKVLILACLVALALARELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDEL
QDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSKVKEAMAPK
HKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSL
SQSKVLPVPQKAVPYPQRDMPIQAFLLYQEPVLGPVRGPFPIIV
(signal sequence, casoparan sequence, and phosphorylation sites shown in red)
Downlaod Bovine Beta Casein PIR sequence file (right click and make sure to save the file with the extension as .pir and not .html)
Elemental Composition:	
Monoistopic Mass		23568.32
Average Mass		23583.29 
pI			5.13 
 
Trypsin Digest





Beta Casein, Bovine            
    Monoisotopic Mass      
Peptide Sequence     1Z 2Z 3Z 4Z 5Z
K     147.1128 74.0564      
R     175.1189 88.0595      
VK     246.1812 123.5906      
HK     284.1717 142.5859      
INK     374.2398 187.6199      
IEK     389.2394 195.1197      
EAMAPK     646.3228 323.6614 216.1076    
GPFPIIV     742.4497 371.7249 248.1499    
EMPFPK     748.3698 374.6849 250.1233    
VLPVPQK     780.4978 390.7489 260.8326    
AVPYPQR     830.4519 415.7260 277.4840    
FQSEEQQQTEDELQDK   1981.8621 991.4311 661.2874 496.2155 397.1724
FQSEEQQQTEDELQDK (1 phos)   2061.8284 1031.4142 687.9428 516.2071 413.1657
DMPIQAFLLYQEPVLGPVR   2186.1678 1093.5839 729.3893 547.2920 438.0336
ELEELNVPGEIVESLSSSEESITR   2646.2992 1323.6496 882.7664 662.3248 530.0598
ELEELNVPGEIVESLSSSEESITR (4 phos)   2966.1645 1483.5823 989.3882 742.2911 594.0329
IHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSK 5316.8533 2658.9267 1772.9511 1329.9633 1064.1707
YPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSK 6359.2558 3180.1279 2120.4186 1590.5640 1272.6512

 

 

References:

 

 

home | disclaimer
Copyright 2000-2016  IonSource.Com  All rights reserved. 
Last updated:  Tuesday, January 19, 2016 02:49:48 PM