Mass Spectrometry Standards at IonSource
return to standards index | return to IonSource
Horse Myoglobin
Expasy Horse Myoglobin Page.
Accession # P68082
Fasta Format
>P68082|MYG_HORSE Myoglobin - Equus caballus (Horse). MGLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASE DLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKH PGDFGADAQGAMTKALELFRNDIAAKYKELGFQGDownload Horse Myoglobin PIR file for use with IsoPro 3.0 (right click and save to disk, make sure extension is .pir)Elemental Composition: C769 H1212 N210 O218 S2Monoistopic Mass 16940.96 (desMet)Average Mass 16951.48 (desMet)pI 7.36Trypsin Digest
Horse Myoglobin ESI Charge States
Monoisotopic Mass
peptide sequence 1Z 2Z 3Z 4Z K 147.1128 HK 284.1717 FK 294.1812 YK 310.1761 HLK 397.2558 FDK 409.2081 205.1041 IPIK 470.3337 235.6669 NDIAAK 631.3409 316.1705 ELGFQG 650.3144 325.6572 ASEDLK 662.3355 331.6678 TEAEMK 708.3232 354.6616 ALELFR 748.4352 374.7176 LFTGHPETLEK 1271.6630 636.3315 424.5543 318.6658 HGTVVLTALGGILK 1378.8416 689.9208 460.2805 345.4604 HPGDFGADAQGAMTK 1502.6692 751.8346 501.5564 376.4173 VEADIAGHGQEVLIR 1606.8547 803.9274 536.2849 402.4637 GLSDGEWQQVLNVWGK 1815.9024 908.4512 605.9675 454.7256 GHHEAELKPLAQSHATK 1853.9616 927.4808 618.6539 464.2404 YLEFISDAIIHVLHSK 1885.0218 943.0109 629.0073 472.0055 oxized variants and conflicts TEAEMK (ox) 724.3182 362.6591 242.1061 181.8296 HPGNFGADAQGAMTK (con, D/N) 1501.6842 751.3421 501.2281 376.1711 HPGDFGADAQGAMTK (ox) 1518.6641 759.8321 506.8880 380.4160 Note: m/z values in blue are commonly observed in nano ESI.
Typical Myoglobin Peptide Map (follow link)
Myoglobin Digest Procedure (follow link)
References:
- Zaia J, Annan RS, Biemann K.
The correct molecular weight of myoglobin, a common calibrant for mass spectrometry.
Rapid Commun Mass Spectrom. 1992 Jan;6(1):32-6.
- Our vendor of choice for this standard is Sigma-Aldrich 60 nmol vials of horse myoglobin Sigma-Aldrich product number A8673-1VL and A8673-5X1VL . Sigma-Aldrich web reference
home
| disclaimer |