Mass Spectrometry Standards at IonSource

return to standards index | return to IonSource

Horse Myoglobin

 

 

Expasy Horse Myoglobin Page.

Accession # P68082

Fasta Format

>P68082|MYG_HORSE Myoglobin - Equus caballus (Horse).
MGLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASE
DLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKH
PGDFGADAQGAMTKALELFRNDIAAKYKELGFQG
Download Horse Myoglobin PIR file for use with IsoPro 3.0
(right click and save to disk, make sure extension is .pir)
Elemental Composition:	C769 H1212 N210 O218 S2 
Monoistopic Mass		16940.96 (desMet)
Average Mass		16951.48  (desMet)
pI			7.36
 
 
Trypsin Digest





Horse Myoglobin

ESI Charge States

Monoisotopic Mass

       
peptide sequence 1Z 2Z 3Z 4Z
K 147.1128      
HK 284.1717      
FK 294.1812      
YK 310.1761      
HLK 397.2558      
FDK 409.2081 205.1041    
IPIK 470.3337 235.6669    
NDIAAK 631.3409 316.1705    
ELGFQG 650.3144 325.6572    
ASEDLK 662.3355 331.6678    
TEAEMK 708.3232 354.6616    
ALELFR 748.4352 374.7176    
LFTGHPETLEK 1271.6630 636.3315 424.5543 318.6658
HGTVVLTALGGILK 1378.8416 689.9208 460.2805 345.4604
HPGDFGADAQGAMTK 1502.6692 751.8346 501.5564 376.4173
VEADIAGHGQEVLIR 1606.8547 803.9274 536.2849 402.4637
GLSDGEWQQVLNVWGK 1815.9024 908.4512 605.9675 454.7256
GHHEAELKPLAQSHATK 1853.9616 927.4808 618.6539 464.2404
YLEFISDAIIHVLHSK 1885.0218 943.0109 629.0073 472.0055
       
oxized variants and conflicts        
TEAEMK (ox) 724.3182 362.6591 242.1061 181.8296
HPGNFGADAQGAMTK (con, D/N) 1501.6842 751.3421 501.2281 376.1711
HPGDFGADAQGAMTK (ox) 1518.6641 759.8321 506.8880 380.4160
       
       
Note: m/z values in blue are commonly observed in nano ESI.

 

Typical Myoglobin Peptide Map (follow link)

Myoglobin Digest Procedure (follow link)

 

References:

  1. Zaia J, Annan RS, Biemann K.
    The correct molecular weight of myoglobin, a common calibrant for mass spectrometry.
    Rapid Commun Mass Spectrom. 1992 Jan;6(1):32-6.
     
  2. Our vendor of choice for this standard is Sigma-Aldrich  60 nmol vials of horse myoglobin Sigma-Aldrich product number A8673-1VL and  A8673-5X1VL . Sigma-Aldrich web reference

 

 

 

home | disclaimer
Copyright © 2000-2016  IonSource.Com  All rights reserved. 
Last updated:  Tuesday, January 19, 2016 02:49:53 PM