return to MFP index | return to IonSource

Bovine Serum Albumin

(BSA)

 

 

Expasy Bovine Serum Albumin Page P02769

>P02769|ALBU_BOVIN Serum albumin - Bos taurus (Bovine).
MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPF
DEHVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCKVASLRETYGDMADCCEKQEP
ERNECFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYY
ANKYNGVFQECCQAEDKGACLLPKIETMREKVLASSARQRLRCASIQKFGERALKAWSVA
RLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLLECADDRADLAKYICDNQDTISSKLKE
CCDKPLLEKSHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAKDAFLGSFLYEYSRR
HPEYAVSVLLRLAKEYEATLEECCAKDDPHACYSTVFDKLKHLVDEPQNLIKQNCDQFEK
LGEYGFQNALIVRYTRKVPQVSTPTLVEVSRSLGKVGTRCCTKPESERMPCTEDYLSLIL
NRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTLP
DTEKQIKKQTALVELLKHKPKATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPKLVV
STQTALA
(signal sequence and all cysteines shown in red) 
 

				
Download BSA PIR file
Elemental composition:	c2932 H4614 N780 O898 S39  
Monoistopic Mass		66389.86  (25-607)
Average Mass		66432.96  (25-607)
pI			5.60
 
 
Trypsin Digest
   Table with cys unmodified, see BSA modified with iodoacetic acid 
 





				
BSA Monoisotopic Mass    
       
peptide sequence 1Z 2Z 3Z 4Z
K 147.1128 74.0564 49.7043 37.5282
R 175.1189 88.0595 59.0396 44.5297
LK 260.1968 130.5984 87.3989 65.7992
EK 276.1554 138.5777 92.7185 69.7889
LR 288.2030 144.6015 96.7343 72.8008
FK 294.1812 147.5906 98.7271 74.2953
QR 303.1775 152.0888 101.7258 76.5444
ALK 331.2340 166.1170 111.0780 83.5585
LAK 331.2340 166.1170 111.0780 83.5585
VTK 347.2289 174.1145 116.4096 87.5572
VHK 383.2401 192.1201 128.4134 96.5600
QIK 388.2554 194.6277 130.0851 97.8139
FPK 391.2340 196.1170 131.0780 98.5585
SLGK 404.2503 202.6252 135.4168 101.8126
VGTR 432.2565 216.6283 144.7522 108.8141
YTR 439.2299 220.1150 147.0766 110.5575
ADEK 462.2194 231.6097 154.7398 116.3049
DVCK 464.2173 232.6087 155.4058 116.8043
LSQK 475.2875 238.1438 159.0958 119.5719
DTHK 500.2463 250.6232 167.4154 125.8116
FGER 508.2514 254.6257 170.0838 127.8129
HKPK 509.3194 255.1597 170.4398 128.0799
ADLAK 517.2980 259.1490 173.0993 130.0745
FWGK 537.2820 269.1410 179.7607 135.0705
VASLR 545.3405 273.1703 182.4468 137.0851
AFDEK 609.2878 305.1439 203.7626 153.0720
IETMR 649.3338 325.1669 217.1113 163.0835
CASIQK 649.3338 325.1669 217.1113 163.0835
QEPER 658.3155 329.6578 220.1052 165.3289
TPVSEK 660.3563 330.6782 220.7854 165.8391
AWSVAR 689.3729 345.1865 230.4576 173.0932
GACLLPK 701.4014 351.2007 234.4671 176.1004
VLASSAR 703.4097 352.2049 235.1366 176.6024
SEIAHR 712.3736 356.6868 238.1245 178.8434
CCAADDK 725.2593 363.1297 242.4198 182.0648
NYQEAK 752.3573 376.6787 251.4524 188.8393
LVTDLTK 789.4716 395.2358 263.8239 198.1179
ATEEQLK 818.4254 409.7127 273.4751 205.3564
LCVLHEK 841.4600 421.2300 281.1533 211.1150
DDSPDLPK 886.4152 443.7076 296.1384 222.3538
AEFVEVTK 922.4880 461.7440 308.1627 231.3720
YLYEIAR 927.4934 464.2467 309.8311 232.6234
DLGEEHFK 974.4577 487.7289 325.4859 244.3644
NECFLSHK 977.4509 489.2255 326.4836 245.1127
LVVSTQTALA 1002.5830 501.7915 334.8610 251.3958
QNCDQFEK 1011.4200 506.2100 337.8067 253.6050
QTALVELLK 1014.6193 507.8097 338.8731 254.4048
SHCIAEVEK 1015.4877 508.2439 339.1626 254.6219
CCTESLVNR 1024.4550 512.7275 342.1517 256.8638
EACFAVEGPK 1050.4924 525.7462 350.8308 263.3731
CCTKPESER 1052.4499 526.7250 351.4833 263.8625
LVNELTEFAK 1163.6306 582.3153 388.5435 291.6577
ECCDKPLLEK 1177.5591 589.2796 393.1864 295.1398
HPEYAVSVLLR 1283.7106 642.3553 428.5702 321.6777
HLVDEPQNLIK 1305.7161 653.3581 435.9054 327.1790
TCVADESHAGCEK 1349.5460 675.2730 450.5153 338.1365
SLHTLFGDELCK 1362.6722 681.8361 454.8907 341.4181
ETYGDMADCCEK 1364.4803 682.7402 455.4934 341.8701
YICDNQDTISSK 1386.6206 693.8103 462.8735 347.4052
EYEATLEECCAK 1388.5708 694.7854 463.5236 347.8927
TVMENFVAFVDK 1399.6926 700.3463 467.2309 350.6732
LGEYGFQNALIVR 1479.7954 740.3977 493.9318 370.6989
DDPHACYSTVFDK 1497.6314 749.3157 499.8771 375.1579
VPQVSTPTLVEVSR 1511.8427 756.4214 504.6142 378.7107
LKPDPNTLCDEFK 1519.7461 760.3731 507.2487 380.6865
DAFLGSFLYEYSR 1567.7427 784.3714 523.2476 392.6857
ECCHGDLLECADDR 1578.5981 789.7991 526.8660 395.3995
YNGVFQECCQAEDK 1633.6621 817.3311 545.2207 409.1655
MPCTEDYLSLILNR 1667.8131 834.4066 556.6044 417.7033
RPCFSALTPDETYVPK 1823.8996 912.4498 608.6332 456.7249
LFTFHADICTLPDTEK 1908.9047 954.9524 636.9682 477.9762
HPYFYAPELLYYANK 1888.9268 944.9634 630.3089 472.9817
DAIPENLPPLTADFAEDK 1955.9596 978.4798 652.6532 489.7399
GLVLIAFSQYLQQCPFDEHV K 2493.2482 1247.1241 831.7494 624.0621
 

 

 

 

 

 

home | disclaimer
Copyright 2000-2016  IonSource.com  All rights reserved. 
Last updated:  Tuesday, January 19, 2016 02:49:40 PM